PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00391.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 249aa    MW: 27001.1 Da    PI: 6.6944
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00391.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.41.7e-0976122551
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                              k  +r   NReA r++R++Kka+ + Le++v  L a N++L k+l+ 
  Rsa1.0_00391.1_g00014.1  76 KSKKRPLGNREAVRKYREKKKAKAASLEDEVTRLRAVNSQLMKRLQG 122
                              66788999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-972139IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.9E-1473140No hitNo description
PROSITE profilePS502178.87574121IPR004827Basic-leucine zipper domain
PfamPF077162.2E-1475129IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.7E-877121No hitNo description
CDDcd146867.52E-1278130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDDGEVEFPL SSSSMDSFFD ELLRDSHACT HTHTCNPPGP ENTHTHTCLH VHTKILPAQT  60
QDKETTDDTS GSSGNKSKKR PLGNREAVRK YREKKKAKAA SLEDEVTRLR AVNSQLMKRL  120
QGQAALEAEV TRLKCLLVDI RGRIEGEIGA FPYQKPVVPN AHFSYTMQPC NMPCGVDNNS  180
LYCLQDGNSG EGSLMNEQGG LDGCEFDQLQ CFADQNLAGC SNGNGTFSAN TSGVATNKRK  240
GGTCAAKAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622657.11e-153PREDICTED: uncharacterized protein LOC106328710
RefseqXP_013685167.11e-153PREDICTED: uncharacterized protein LOC106389454
SwissprotQ8GTS21e-135BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A078DRD61e-153A0A078DRD6_BRANA; BnaC03g46620D protein
TrEMBLA0A0D3BE211e-153A0A0D3BE21_BRAOL; Uncharacterized protein
STRINGBra037290.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-131bZIP family protein